Anti IL37 pAb (ATL-HPA054371)

Atlas Antibodies

SKU: ATL-HPA054371-25

• 

Protein Description: interleukin 37
Gene Name: IL37
Alternative Gene Name: FIL1, FIL1(ZETA), FIL1Z, IL-1F7, IL-1H4, IL-1RP1, IL1F7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026983: 32%, ENSRNOG00000005701: 31%
Entrez Gene ID: 27178
Uniprot ID: Q9NZH6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSE
• Gene Sequence: LYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSE
• Gene ID - Mouse: ENSMUSG00000026983
• Gene ID - Rat: ENSRNOG00000005701
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IL37 pAb (ATL-HPA054371) – 1 Found

Lachner, Julia; Mlitz, Veronika; Tschachler, Erwin; Eckhart, Leopold. Epidermal cornification is preceded by the expression of a keratinocyte-specific set of pyroptosis-related genes. Scientific Reports. 2017;7(1):17446.