Protein Description: interleukin 20 receptor subunit beta
Gene Name: IL20RB
Alternative Gene Name: DIRS1, FNDC6, IL-20R2, MGC34923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044244: 85%, ENSRNOG00000023214: 76%
Entrez Gene ID: 53833
Uniprot ID: Q6UXL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IL20RB
Alternative Gene Name: DIRS1, FNDC6, IL-20R2, MGC34923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044244: 85%, ENSRNOG00000023214: 76%
Entrez Gene ID: 53833
Uniprot ID: Q6UXL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE |
| Documents & Links for Anti IL20RB pAb (ATL-HPA063914) | |
| Datasheet | Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link) |
| Vendor Page | Anti IL20RB pAb (ATL-HPA063914) at Atlas |
| Documents & Links for Anti IL20RB pAb (ATL-HPA063914) | |
| Datasheet | Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link) |
| Vendor Page | Anti IL20RB pAb (ATL-HPA063914) |