Anti IL20RB pAb (ATL-HPA063914)

Atlas Antibodies

SKU:
ATL-HPA063914-25
  • Immunofluorescent staining of human cell line hTCEpi shows localization to cytosol & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: interleukin 20 receptor subunit beta
Gene Name: IL20RB
Alternative Gene Name: DIRS1, FNDC6, IL-20R2, MGC34923
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044244: 85%, ENSRNOG00000023214: 76%
Entrez Gene ID: 53833
Uniprot ID: Q6UXL0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
Gene Sequence QFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGE
Gene ID - Mouse ENSMUSG00000044244
Gene ID - Rat ENSRNOG00000023214
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IL20RB pAb (ATL-HPA063914)
Datasheet Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link)
Vendor Page Anti IL20RB pAb (ATL-HPA063914) at Atlas Antibodies

Documents & Links for Anti IL20RB pAb (ATL-HPA063914)
Datasheet Anti IL20RB pAb (ATL-HPA063914) Datasheet (External Link)
Vendor Page Anti IL20RB pAb (ATL-HPA063914)