Anti IL13RA2 pAb (ATL-HPA045831)

Atlas Antibodies

Catalog No.: ATL-HPA045831-25

Protein Description: interleukin 13 receptor subunit alpha 2
Gene Name: IL13RA2
Alternative Gene Name: CD213a2, CT19, IL-13R, IL13BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031289: 73%, ENSRNOG00000032973: 74%
Entrez Gene ID: 3598
Uniprot ID: Q14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
• Gene Sequence: YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS
• Gene ID - Mouse: ENSMUSG00000031289
• Gene ID - Rat: ENSRNOG00000032973
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.