Anti IL13RA2 pAb (ATL-HPA045831)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045831-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: IL13RA2
Alternative Gene Name: CD213a2, CT19, IL-13R, IL13BP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031289: 73%, ENSRNOG00000032973: 74%
Entrez Gene ID: 3598
Uniprot ID: Q14627
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS |
Gene Sequence | YLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQS |
Gene ID - Mouse | ENSMUSG00000031289 |
Gene ID - Rat | ENSRNOG00000032973 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IL13RA2 pAb (ATL-HPA045831) | |
Datasheet | Anti IL13RA2 pAb (ATL-HPA045831) Datasheet (External Link) |
Vendor Page | Anti IL13RA2 pAb (ATL-HPA045831) at Atlas Antibodies |
Documents & Links for Anti IL13RA2 pAb (ATL-HPA045831) | |
Datasheet | Anti IL13RA2 pAb (ATL-HPA045831) Datasheet (External Link) |
Vendor Page | Anti IL13RA2 pAb (ATL-HPA045831) |