Anti IL10RA pAb (ATL-HPA069086)

Atlas Antibodies

SKU: ATL-HPA069086-25

• 

Product Description

Protein Description: interleukin 10 receptor subunit alpha
Gene Name: IL10RA
Alternative Gene Name: CD210, CD210a, CDW210A, HIL-10R, IL10R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032089: 69%, ENSRNOG00000016308: 70%
Entrez Gene ID: 3587
Uniprot ID: Q13651
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL
• Gene Sequence: HGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDL
• Gene ID - Mouse: ENSMUSG00000032089
• Gene ID - Rat: ENSRNOG00000016308
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links