Anti IKZF4 pAb (ATL-HPA046270)

Atlas Antibodies

SKU: ATL-HPA046270-25

• 
• 

Protein Description: IKAROS family zinc finger 4 (Eos)
Gene Name: IKZF4
Alternative Gene Name: Eos, ZNFN1A4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002578: 90%, ENSRNOG00000005535: 91%
Entrez Gene ID: 64375
Uniprot ID: Q9H2S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGA
• Gene Sequence: VNSGGYEKDVELVAHHSLEPGFGSSLAFVGAEHLRPLRLPPTNCISELTPVISSVYTQMQPLPGRLELPGSREAGEGPEDLADGGPLLYRPRGPLTDPGA
• Gene ID - Mouse: ENSMUSG00000002578
• Gene ID - Rat: ENSRNOG00000005535
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.