Anti IKBKAP pAb (ATL-HPA050686)

Atlas Antibodies

SKU: ATL-HPA050686-25

• 

Protein Description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase complex-associated protein
Gene Name: IKBKAP
Alternative Gene Name: DYS, ELP1, IKAP, IKI3, TOT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028431: 80%, ENSRNOG00000016725: 77%
Entrez Gene ID: 8518
Uniprot ID: O95163
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG
• Gene Sequence: RLHVLCQGWHYLAYDWHWTTDRSVGDNSSDLSNVAVIDGNRVLVTVFRQTVVPPPMCTYQLLFPHPVNQVTFLAHPQKSNDLAVLDASNQISVYKCGDCPSADPTVKLGAVG
• Gene ID - Mouse: ENSMUSG00000028431
• Gene ID - Rat: ENSRNOG00000016725
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.