Anti IGSF11 pAb (ATL-HPA046377 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046377-100
  • Immunohistochemical staining of human tonsil shows strong membranous positivity in squamous epithelial cells.
  • Immunofluorescent staining of human cell line A549 shows localization to nucleus, cytosol & cell junctions.
  • Western blot analysis in human cell lines SK-MEL-30 and U-251MG using Anti-IGSF11 antibody. Corresponding IGSF11 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: immunoglobulin superfamily, member 11
Gene Name: IGSF11
Alternative Gene Name: BT-IgSF, CT119, Igsf13, MGC35227, VSIG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022790: 84%, ENSRNOG00000001525: 84%
Entrez Gene ID: 152404
Uniprot ID: Q5DX21
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP
Gene Sequence PPKCSSAKAFHTEISSSDNNTLTSSNAYNSRYWSNNPKVHRNTESVSHFSDLGQSFSFHSGNANIPSIYANGTHLVPGQHKTLVVTANRGSSPQVMSRSNGSVSRKP
Gene ID - Mouse ENSMUSG00000022790
Gene ID - Rat ENSRNOG00000001525
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti IGSF11 pAb (ATL-HPA046377 w/enhanced validation)
Datasheet Anti IGSF11 pAb (ATL-HPA046377 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti IGSF11 pAb (ATL-HPA046377 w/enhanced validation)