Anti IGFBP5 pAb (ATL-HPA059827)

Atlas Antibodies

SKU: ATL-HPA059827-25

• 

Protein Description: insulin like growth factor binding protein 5
Gene Name: IGFBP5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026185: 95%, ENSRNOG00000017206: 93%
Entrez Gene ID: 3488
Uniprot ID: P24593
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
• Gene Sequence: DRRKKLTQSKFVGGAENTAHPRIISAPEMRQESEQGPCRRHMEASLQELKASPRMV
• Gene ID - Mouse: ENSMUSG00000026185
• Gene ID - Rat: ENSRNOG00000017206
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGFBP5 pAb (ATL-HPA059827) – 1 Found

Deng, Yu; Yang, Xu; Hua, Hongzhong; Zhang, Cong. IGFBP5 is Upregulated and Associated with Poor Prognosis in Colorectal Cancer. International Journal Of General Medicine. 15( 35966504):6485-6497.