Anti IGFBP1 pAb (ATL-HPA046972 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046972-25

• 
• 

Protein Description: insulin-like growth factor binding protein 1
Gene Name: IGFBP1
Alternative Gene Name: AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020429: 55%, ENSRNOG00000058780: 56%
Entrez Gene ID: 3484
Uniprot ID: P08833
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS
• Gene Sequence: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS
• Gene ID - Mouse: ENSMUSG00000020429
• Gene ID - Rat: ENSRNOG00000058780
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGFBP1 pAb (ATL-HPA046972 w/enhanced validation) – 1 Found

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038.