Anti IGF1 pAb (ATL-HPA048946)

Atlas Antibodies

SKU: ATL-HPA048946-25

• 

Protein Description: insulin-like growth factor 1 (somatomedin C)
Gene Name: IGF1
Alternative Gene Name: IGF-I, IGF1A, IGFI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020053: 91%, ENSRNOG00000004517: 93%
Entrez Gene ID: 3479
Uniprot ID: P05019
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
• Gene Sequence: CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
• Gene ID - Mouse: ENSMUSG00000020053
• Gene ID - Rat: ENSRNOG00000004517
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IGF1 pAb (ATL-HPA048946) – 2 Found

Darmanis, Spyros; Cui, Tao; Drobin, Kimi; Li, Su-Chen; Öberg, Kjell; Nilsson, Peter; Schwenk, Jochen M; Giandomenico, Valeria. Identification of candidate serum proteins for classifying well-differentiated small intestinal neuroendocrine tumors. Plos One. 8(11):e81712. 

Tao, Anqi; Wang, Xing; Li, Cuiying. Effect of Lycopene on Oral Squamous Cell Carcinoma Cell Growth by Inhibiting IGF1 Pathway. Cancer Management And Research. 13( 33531840):723-732.