Anti IFT52 pAb (ATL-HPA067423 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA067423-25

• 

Product Description

Protein Description: intraflagellar transport 52
Gene Name: IFT52
Alternative Gene Name: C20orf9, CGI-53, dJ1028D15.1, NGD2, NGD5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017858: 95%, ENSRNOG00000017707: 27%
Entrez Gene ID: 51098
Uniprot ID: Q9Y366
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA
• Gene Sequence: EPLQLIQPQFETPLPTLQPAVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTEEDLEFYVRKCGDILGVTSKLPKDQQDA
• Gene ID - Mouse: ENSMUSG00000017858
• Gene ID - Rat: ENSRNOG00000017707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links