Anti IFIT3 pAb (ATL-HPA059914 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059914-25

• 
• 
• 

Protein Description: interferon-induced protein with tetratricopeptide repeats 3
Gene Name: IFIT3
Alternative Gene Name: CIG-49, GARG-49, IFI60, IFIT4, IRG2, ISG60, RIG-G
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079628: 31%, ENSRNOG00000049007: 29%
Entrez Gene ID: 3437
Uniprot ID: O14879
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
• Gene Sequence: HKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQL
• Gene ID - Mouse: ENSMUSG00000079628
• Gene ID - Rat: ENSRNOG00000049007
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti IFIT3 pAb (ATL-HPA059914 w/enhanced validation) – 1 Found

Gao, Li; Xiong, Dan-Dan; He, Rong-Quan; Lai, Ze-Feng; Liu, Li-Min; Huang, Zhi-Guang; Yang, Xia; Wu, Hua-Yu; Yang, Li-Hua; Ma, Jie; Li, Sheng-Hua; Lin, Peng; Yang, Hong; Luo, Dian-Zhong; Chen, Gang; Dang, Yi-Wu. Identifying TF-miRNA-mRNA regulatory modules in nitidine chloride treated HCC xenograft of nude mice. American Journal Of Translational Research. 11(12):7503-7522.