Anti IFI44L pAb (ATL-HPA060372)

Atlas Antibodies

SKU:
ATL-HPA060372-100
  • Immunohistochemical staining of human urinary bladder shows weak cytoplasmic positivity in urothelial cells.
  • Western blot analysis in human cell line U-87 MG.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: interferon-induced protein 44-like
Gene Name: IFI44L
Alternative Gene Name: C1orf29, GS3686
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030187: 26%, ENSRNOG00000049994: 33%
Entrez Gene ID: 10964
Uniprot ID: Q53G44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLL
Gene Sequence IIDEQLVCRLSKTDIFIICRDNKIYLDKMITRNLKLRFYGHRQYLECEVFRVEGIKDNLDDIKRIIKAREHRNRLL
Gene ID - Mouse ENSMUSG00000030187
Gene ID - Rat ENSRNOG00000049994
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IFI44L pAb (ATL-HPA060372)
Datasheet Anti IFI44L pAb (ATL-HPA060372) Datasheet (External Link)
Vendor Page Anti IFI44L pAb (ATL-HPA060372) at Atlas Antibodies

Documents & Links for Anti IFI44L pAb (ATL-HPA060372)
Datasheet Anti IFI44L pAb (ATL-HPA060372) Datasheet (External Link)
Vendor Page Anti IFI44L pAb (ATL-HPA060372)