Anti IFFO1 pAb (ATL-HPA069344)

Atlas Antibodies

SKU: ATL-HPA069344-25

• 

Protein Description: intermediate filament family orphan 1
Gene Name: IFFO1
Alternative Gene Name: HOM-TES-103, IFFO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038271: 100%, ENSRNOG00000018533: 100%
Entrez Gene ID: 25900
Uniprot ID: Q0D2I5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
• Gene Sequence: LLWEDFSGYAMAAAEAQGEQQEDSLEKVIKDTESLFKTR
• Gene ID - Mouse: ENSMUSG00000038271
• Gene ID - Rat: ENSRNOG00000018533
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.