Anti IDUA pAb (ATL-HPA046979)

Atlas Antibodies

SKU:
ATL-HPA046979-100
  • Immunohistochemical staining of human Endometrium shows moderate cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line HEK 293.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: iduronidase, alpha-L-
Gene Name: IDUA
Alternative Gene Name: MPS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033540: 86%, ENSRNOG00000000043: 85%
Entrez Gene ID: 3425
Uniprot ID: P35475
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE
Gene Sequence VFEWKDLVSSLARRYIGRYGLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRHCHDGTNFFTGE
Gene ID - Mouse ENSMUSG00000033540
Gene ID - Rat ENSRNOG00000000043
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IDUA pAb (ATL-HPA046979)
Datasheet Anti IDUA pAb (ATL-HPA046979) Datasheet (External Link)
Vendor Page Anti IDUA pAb (ATL-HPA046979) at Atlas Antibodies

Documents & Links for Anti IDUA pAb (ATL-HPA046979)
Datasheet Anti IDUA pAb (ATL-HPA046979) Datasheet (External Link)
Vendor Page Anti IDUA pAb (ATL-HPA046979)