Anti IDH3B pAb (ATL-HPA049387 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA049387-25

• 
• 
• 

Protein Description: isocitrate dehydrogenase 3 (NAD+) beta
Gene Name: IDH3B
Alternative Gene Name: RP46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027406: 96%, ENSRNOG00000007316: 96%
Entrez Gene ID: 3420
Uniprot ID: O43837
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
• Gene Sequence: VKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNN
• Gene ID - Mouse: ENSMUSG00000027406
• Gene ID - Rat: ENSRNOG00000007316
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.