Anti ICAM3 pAb (ATL-HPA049820)

Atlas Antibodies

SKU: ATL-HPA049820-25

• 

Protein Description: intercellular adhesion molecule 3
Gene Name: ICAM3
Alternative Gene Name: CD50, CDW50, ICAM-R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020712: 37%, ENSRNOG00000010929: 39%
Entrez Gene ID: 3385
Uniprot ID: P32942
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT
• Gene Sequence: AGGSLFVNCSTDCPSSEKIALETSLSKELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQIT
• Gene ID - Mouse: ENSMUSG00000020712
• Gene ID - Rat: ENSRNOG00000010929
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.