Anti IBTK pAb (ATL-HPA048438)

Atlas Antibodies

SKU:
ATL-HPA048438-25
  • Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: inhibitor of Bruton agammaglobulinemia tyrosine kinase
Gene Name: IBTK
Alternative Gene Name: BTBD26, BTKI, DKFZP564B116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035941: 88%, ENSRNOG00000027728: 89%
Entrez Gene ID: 25998
Uniprot ID: Q9P2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADEMDSIHDVTFQVGN
Gene Sequence ILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADEMDSIHDVTFQVGN
Gene ID - Mouse ENSMUSG00000035941
Gene ID - Rat ENSRNOG00000027728
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti IBTK pAb (ATL-HPA048438)
Datasheet Anti IBTK pAb (ATL-HPA048438) Datasheet (External Link)
Vendor Page Anti IBTK pAb (ATL-HPA048438) at Atlas Antibodies

Documents & Links for Anti IBTK pAb (ATL-HPA048438)
Datasheet Anti IBTK pAb (ATL-HPA048438) Datasheet (External Link)
Vendor Page Anti IBTK pAb (ATL-HPA048438)