Anti IBTK pAb (ATL-HPA048438)
Atlas Antibodies
- SKU:
- ATL-HPA048438-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: IBTK
Alternative Gene Name: BTBD26, BTKI, DKFZP564B116
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035941: 88%, ENSRNOG00000027728: 89%
Entrez Gene ID: 25998
Uniprot ID: Q9P2D0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADEMDSIHDVTFQVGN |
Gene Sequence | ILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSYVSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADEMDSIHDVTFQVGN |
Gene ID - Mouse | ENSMUSG00000035941 |
Gene ID - Rat | ENSRNOG00000027728 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti IBTK pAb (ATL-HPA048438) | |
Datasheet | Anti IBTK pAb (ATL-HPA048438) Datasheet (External Link) |
Vendor Page | Anti IBTK pAb (ATL-HPA048438) at Atlas Antibodies |
Documents & Links for Anti IBTK pAb (ATL-HPA048438) | |
Datasheet | Anti IBTK pAb (ATL-HPA048438) Datasheet (External Link) |
Vendor Page | Anti IBTK pAb (ATL-HPA048438) |