Protein Description: isoamyl acetate hydrolyzing esterase 1 (putative)
Gene Name: IAH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062054: 70%, ENSRNOG00000060853: 74%
Entrez Gene ID: 285148
Uniprot ID: Q2TAA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: IAH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062054: 70%, ENSRNOG00000060853: 74%
Entrez Gene ID: 285148
Uniprot ID: Q2TAA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KQHIPLEEYAANLKSMVQYLKSVDIPENRVILITPTPLCETAWEEQCIIQGCKL |
| Documents & Links for Anti IAH1 pAb (ATL-HPA076040) | |
| Datasheet | Anti IAH1 pAb (ATL-HPA076040) Datasheet (External Link) |
| Vendor Page | Anti IAH1 pAb (ATL-HPA076040) at Atlas |
| Documents & Links for Anti IAH1 pAb (ATL-HPA076040) | |
| Datasheet | Anti IAH1 pAb (ATL-HPA076040) Datasheet (External Link) |
| Vendor Page | Anti IAH1 pAb (ATL-HPA076040) |