Anti HYAL3 pAb (ATL-HPA049402)
Atlas Antibodies
- SKU:
- ATL-HPA049402-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HYAL3
Alternative Gene Name: LUCA-3, LUCA14, Minna14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036091: 71%, ENSRNOG00000016093: 77%
Entrez Gene ID: 8372
Uniprot ID: O43820
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR |
Gene Sequence | AAYQIHHSLRPGFAGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARALMEDTLRVAQALR |
Gene ID - Mouse | ENSMUSG00000036091 |
Gene ID - Rat | ENSRNOG00000016093 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HYAL3 pAb (ATL-HPA049402) | |
Datasheet | Anti HYAL3 pAb (ATL-HPA049402) Datasheet (External Link) |
Vendor Page | Anti HYAL3 pAb (ATL-HPA049402) at Atlas Antibodies |
Documents & Links for Anti HYAL3 pAb (ATL-HPA049402) | |
Datasheet | Anti HYAL3 pAb (ATL-HPA049402) Datasheet (External Link) |
Vendor Page | Anti HYAL3 pAb (ATL-HPA049402) |