Protein Description: huntingtin
Gene Name: HTT
Alternative Gene Name: HD, IT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029104: 82%, ENSRNOG00000011073: 85%
Entrez Gene ID: 3064
Uniprot ID: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HTT
Alternative Gene Name: HD, IT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029104: 82%, ENSRNOG00000011073: 85%
Entrez Gene ID: 3064
Uniprot ID: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD |
Gene Sequence | LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD |
Gene ID - Mouse | ENSMUSG00000029104 |
Gene ID - Rat | ENSRNOG00000011073 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation) | |
Datasheet | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) at Atlas |
Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation) | |
Datasheet | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti HTT pAb (ATL-HPA026114 w/enhanced validation) |