Anti HTT pAb (ATL-HPA026114 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026114-25
  • Immunohistochemistry analysis in human cerebral cortex and liver tissues using Anti-HTT antibody. Corresponding HTT RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: huntingtin
Gene Name: HTT
Alternative Gene Name: HD, IT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029104: 82%, ENSRNOG00000011073: 85%
Entrez Gene ID: 3064
Uniprot ID: P42858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD
Gene Sequence LQQAHLLKNMSHCRQPSDSSVDKFVLRDEATEPGDQENKPCRIKGDIGQSTDDDSAPLVHCVRLLSASFLLTGGKNVLVPDRDVRVSVKALALSCVGAAVALHPESFFSKLYKVPLD
Gene ID - Mouse ENSMUSG00000029104
Gene ID - Rat ENSRNOG00000011073
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation)
Datasheet Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HTT pAb (ATL-HPA026114 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HTT pAb (ATL-HPA026114 w/enhanced validation)
Datasheet Anti HTT pAb (ATL-HPA026114 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HTT pAb (ATL-HPA026114 w/enhanced validation)