Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045402-25
  • Immunohistochemical staining of human testis shows no positivity in cells in seminiferous ducts as expected.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: HtrA serine peptidase 4
Gene Name: HTRA4
Alternative Gene Name: FLJ90724
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037406: 68%, ENSRNOG00000061160: 71%
Entrez Gene ID: 203100
Uniprot ID: P83105
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSG
Gene Sequence FAIPSDRVRQFLAEYHEHQMKGKAFSNKKYLGLQMLSLTVPLSEELKMHYPDFPDVSSG
Gene ID - Mouse ENSMUSG00000037406
Gene ID - Rat ENSRNOG00000061160
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation)
Datasheet Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation)
Datasheet Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HTRA4 pAb (ATL-HPA045402 w/enhanced validation)