Anti HTRA3 pAb (ATL-HPA021187)

Atlas Antibodies

Catalog No.: ATL-HPA021187-25

Protein Description: HtrA serine peptidase 3
Gene Name: HTRA3
Alternative Gene Name: Prsp, Tasp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029096: 89%, ENSRNOG00000008182: 90%
Entrez Gene ID: 94031
Uniprot ID: P83110
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAP
• Gene Sequence: ITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAP
• Gene ID - Mouse: ENSMUSG00000029096
• Gene ID - Rat: ENSRNOG00000008182
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HTRA3 pAb (ATL-HPA021187) – 1 Found

Crochemore, Clément; Fernández-Molina, Cristina; Montagne, Benjamin; Salles, Audrey; Ricchetti, Miria. CSB promoter downregulation via histone H3 hypoacetylation is an early determinant of replicative senescence. Nature Communications. 2019;10(1):5576.