Anti HTR3E pAb (ATL-HPA049764)
Atlas Antibodies
- SKU:
- ATL-HPA049764-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: HTR3E
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031796: 33%, ENSRNOG00000026944: 27%
Entrez Gene ID: 285242
Uniprot ID: A5X5Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF |
Gene Sequence | LAFILSRATPRPALGPLSYREHRVALLHLTHSMSTTGRGVTFTINCSGF |
Gene ID - Mouse | ENSMUSG00000031796 |
Gene ID - Rat | ENSRNOG00000026944 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HTR3E pAb (ATL-HPA049764) | |
Datasheet | Anti HTR3E pAb (ATL-HPA049764) Datasheet (External Link) |
Vendor Page | Anti HTR3E pAb (ATL-HPA049764) at Atlas Antibodies |
Documents & Links for Anti HTR3E pAb (ATL-HPA049764) | |
Datasheet | Anti HTR3E pAb (ATL-HPA049764) Datasheet (External Link) |
Vendor Page | Anti HTR3E pAb (ATL-HPA049764) |