Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA054811-25
  • Immunohistochemistry analysis in human skeletal muscle and skin tissues using Anti-HSPB6 antibody. Corresponding HSPB6 RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human Skeletal muscle tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: heat shock protein, alpha-crystallin-related, B6
Gene Name: HSPB6
Alternative Gene Name: FLJ32389, Hsp20, PPP1R91
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036854: 97%, ENSRNOG00000020922: 90%
Entrez Gene ID: 126393
Uniprot ID: O14558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MEIPVPVQPSWLRRASAPLPGLSAPGRLFD
Gene Sequence MEIPVPVQPSWLRRASAPLPGLSAPGRLFD
Gene ID - Mouse ENSMUSG00000036854
Gene ID - Rat ENSRNOG00000020922
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation)
Datasheet Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation)
Datasheet Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation)