Anti HSPB6 pAb (ATL-HPA054811 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA054811-25

• 
• 

Protein Description: heat shock protein, alpha-crystallin-related, B6
Gene Name: HSPB6
Alternative Gene Name: FLJ32389, Hsp20, PPP1R91
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036854: 97%, ENSRNOG00000020922: 90%
Entrez Gene ID: 126393
Uniprot ID: O14558
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEIPVPVQPSWLRRASAPLPGLSAPGRLFD
• Gene Sequence: MEIPVPVQPSWLRRASAPLPGLSAPGRLFD
• Gene ID - Mouse: ENSMUSG00000036854
• Gene ID - Rat: ENSRNOG00000020922
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.