Protein Description: heat shock protein family B (small) member 2
Gene Name: HSPB2
Alternative Gene Name: Hs.78846, MKBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038086: 96%, ENSRNOG00000010402: 96%
Entrez Gene ID: 3316
Uniprot ID: Q16082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSPB2
Alternative Gene Name: Hs.78846, MKBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038086: 96%, ENSRNOG00000010402: 96%
Entrez Gene ID: 3316
Uniprot ID: Q16082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFT |
Documents & Links for Anti HSPB2 pAb (ATL-HPA079414) | |
Datasheet | Anti HSPB2 pAb (ATL-HPA079414) Datasheet (External Link) |
Vendor Page | Anti HSPB2 pAb (ATL-HPA079414) at Atlas |
Documents & Links for Anti HSPB2 pAb (ATL-HPA079414) | |
Datasheet | Anti HSPB2 pAb (ATL-HPA079414) Datasheet (External Link) |
Vendor Page | Anti HSPB2 pAb (ATL-HPA079414) |