Anti HSPB2 pAb (ATL-HPA079414)

Atlas Antibodies

SKU: ATL-HPA079414-25

• 

Product Description

Protein Description: heat shock protein family B (small) member 2
Gene Name: HSPB2
Alternative Gene Name: Hs.78846, MKBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038086: 96%, ENSRNOG00000010402: 96%
Entrez Gene ID: 3316
Uniprot ID: Q16082
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFT
• Gene Sequence: MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFT
• Gene ID - Mouse: ENSMUSG00000038086
• Gene ID - Rat: ENSRNOG00000010402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links