Anti HSPA14 pAb (ATL-HPA046180)

Atlas Antibodies

SKU:
ATL-HPA046180-25
  • Immunohistochemical staining of human vagina shows strong cytoplasmic and membranous positivity in squamous epithelial cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: heat shock 70kDa protein 14
Gene Name: HSPA14
Alternative Gene Name: HSP70-4, HSP70L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109865: 92%, ENSRNOG00000015212: 96%
Entrez Gene ID: 51182
Uniprot ID: Q0VDF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTDQETGKCEAIS
Gene Sequence FTVLFPSGTPLPARRQHTLQAPGSISSVCLELYESDGKNSAKEETKFAQVVLQDLDKKENGLRDILAVLTMKRDGSLHVTCTDQETGKCEAIS
Gene ID - Mouse ENSMUSG00000109865
Gene ID - Rat ENSRNOG00000015212
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HSPA14 pAb (ATL-HPA046180)
Datasheet Anti HSPA14 pAb (ATL-HPA046180) Datasheet (External Link)
Vendor Page Anti HSPA14 pAb (ATL-HPA046180) at Atlas Antibodies

Documents & Links for Anti HSPA14 pAb (ATL-HPA046180)
Datasheet Anti HSPA14 pAb (ATL-HPA046180) Datasheet (External Link)
Vendor Page Anti HSPA14 pAb (ATL-HPA046180)