Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA050453-25

• 
• 
• 

Protein Description: hydroxysteroid dehydrogenase like 2
Gene Name: HSDL2
Alternative Gene Name: C9orf99, SDR13C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028383: 88%, ENSRNOG00000016692: 88%
Entrez Gene ID: 84263
Uniprot ID: Q6YN16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFL
• Gene Sequence: AKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLGGPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFL
• Gene ID - Mouse: ENSMUSG00000028383
• Gene ID - Rat: ENSRNOG00000016692
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HSDL2 pAb (ATL-HPA050453 w/enhanced validation) – 3 Found

Zhang, Deng-Yong; Liu, Zhong; Lu, Zheng; Sun, Wan-Liang; Ma, Xiang; Zhang, Pei; Wu, Bin-Quan; Cui, Pei-Yuan. Lentivirus-mediated overexpression of HSDL2 suppresses cell proliferation and induces apoptosis in cholangiocarcinoma. Oncotargets And Therapy. 11( 30410369):7133-7142. 

Sun, Qing; Zhang, Yilin; Su, Juanjuan; Li, Tiechen; Jiang, Yuxin. Role of Hydroxysteroid Dehydrogenase-Like 2 (HSDL2) in Human Ovarian Cancer. Medical Science Monitor : International Medical Journal Of Experimental And Clinical Research. 2018;24( 29894468):3997-4008. 

Soler, Laura; Alves, Sabine; Brionne, Aurélien; Jacques, Aurore; Guérin, Vanessa; Cherif-Feildel, Maeva; Combes-Soia, Lucie; Fouchécourt, Sophie; Thélie, Aurore; Blesbois, Elisabeth; McGrew, Michael J; Labas, Valérie; Govoroun, Marina S. Protein expression reveals a molecular sexual identity of avian primordial germ cells at pre-gonadal stages. Scientific Reports. 2021;11(1):19236.