Anti HSD17B6 pAb (ATL-HPA059141 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA059141-25

• 

Protein Description: hydroxysteroid (17-beta) dehydrogenase 6
Gene Name: HSD17B6
Alternative Gene Name: HSE, RODH, SDR9C6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025396: 48%, ENSRNOG00000007758: 44%
Entrez Gene ID: 8630
Uniprot ID: O14756
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL
• Gene Sequence: VEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQQYFDALYNIMKEGLL
• Gene ID - Mouse: ENSMUSG00000025396
• Gene ID - Rat: ENSRNOG00000007758
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.