Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA065296-25

• 

Protein Description: hydroxysteroid (17-beta) dehydrogenase 1
Gene Name: HSD17B1
Alternative Gene Name: EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019301: 74%, ENSRNOG00000019830: 77%
Entrez Gene ID: 3292
Uniprot ID: P14061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG
• Gene Sequence: ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG
• Gene ID - Mouse: ENSMUSG00000019301
• Gene ID - Rat: ENSRNOG00000019830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.