Protein Description: hydroxysteroid (17-beta) dehydrogenase 1
Gene Name: HSD17B1
Alternative Gene Name: EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019301: 74%, ENSRNOG00000019830: 77%
Entrez Gene ID: 3292
Uniprot ID: P14061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HSD17B1
Alternative Gene Name: EDH17B2, EDHB17, HSD17, MGC138140, SDR28C1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019301: 74%, ENSRNOG00000019830: 77%
Entrez Gene ID: 3292
Uniprot ID: P14061
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ALDPSQSFKVYATLRDLKTQGRLWEAARALACPQG |
| Documents & Links for Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) | |
| Datasheet | Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) at Atlas |
| Documents & Links for Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) | |
| Datasheet | Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti HSD17B1 pAb (ATL-HPA065296 w/enhanced validation) |