Anti HSD11B1L pAb (ATL-HPA049078)

Atlas Antibodies

SKU:
ATL-HPA049078-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: hydroxysteroid (11-beta) dehydrogenase 1-like
Gene Name: HSD11B1L
Alternative Gene Name: SCDR10, SDR26C2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016194: 41%, ENSRNOG00000005861: 38%
Entrez Gene ID: 374875
Uniprot ID: Q7Z5J1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Gene Sequence DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS
Gene ID - Mouse ENSMUSG00000016194
Gene ID - Rat ENSRNOG00000005861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HSD11B1L pAb (ATL-HPA049078)
Datasheet Anti HSD11B1L pAb (ATL-HPA049078) Datasheet (External Link)
Vendor Page Anti HSD11B1L pAb (ATL-HPA049078) at Atlas Antibodies

Documents & Links for Anti HSD11B1L pAb (ATL-HPA049078)
Datasheet Anti HSD11B1L pAb (ATL-HPA049078) Datasheet (External Link)
Vendor Page Anti HSD11B1L pAb (ATL-HPA049078)