Anti HRG pAb (ATL-HPA050269)

Atlas Antibodies

SKU:
ATL-HPA050269-25
  • Immunohistochemical staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: histidine-rich glycoprotein
Gene Name: HRG
Alternative Gene Name: HPRG, HRGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022877: 76%, ENSRNOG00000001809: 71%
Entrez Gene ID: 3273
Uniprot ID: P04196
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG
Gene Sequence HSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGG
Gene ID - Mouse ENSMUSG00000022877
Gene ID - Rat ENSRNOG00000001809
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HRG pAb (ATL-HPA050269)
Datasheet Anti HRG pAb (ATL-HPA050269) Datasheet (External Link)
Vendor Page Anti HRG pAb (ATL-HPA050269) at Atlas Antibodies

Documents & Links for Anti HRG pAb (ATL-HPA050269)
Datasheet Anti HRG pAb (ATL-HPA050269) Datasheet (External Link)
Vendor Page Anti HRG pAb (ATL-HPA050269)



Citations for Anti HRG pAb (ATL-HPA050269) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed