Protein Description: hemopexin
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 67%, ENSRNOG00000018257: 71%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HPX
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030895: 67%, ENSRNOG00000018257: 71%
Entrez Gene ID: 3263
Uniprot ID: P02790
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLI |
| Documents & Links for Anti HPX pAb (ATL-HPA065318) | |
| Datasheet | Anti HPX pAb (ATL-HPA065318) Datasheet (External Link) |
| Vendor Page | Anti HPX pAb (ATL-HPA065318) at Atlas |
| Documents & Links for Anti HPX pAb (ATL-HPA065318) | |
| Datasheet | Anti HPX pAb (ATL-HPA065318) Datasheet (External Link) |
| Vendor Page | Anti HPX pAb (ATL-HPA065318) |
| Citations for Anti HPX pAb (ATL-HPA065318) – 1 Found |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |