Anti HPSE2 pAb (ATL-HPA044603)
Atlas Antibodies
- SKU:
- ATL-HPA044603-25
- Shipping:
- Calculated at Checkout
$303.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Gene Name: HPSE2
Alternative Gene Name: HPA2, HPR2, UFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074852: 96%, ENSRNOG00000011852: 25%
Entrez Gene ID: 60495
Uniprot ID: Q8WWQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY |
Gene Sequence | GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY |
Gene ID - Mouse | ENSMUSG00000074852 |
Gene ID - Rat | ENSRNOG00000011852 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti HPSE2 pAb (ATL-HPA044603) | |
Datasheet | Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link) |
Vendor Page | Anti HPSE2 pAb (ATL-HPA044603) at Atlas Antibodies |
Documents & Links for Anti HPSE2 pAb (ATL-HPA044603) | |
Datasheet | Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link) |
Vendor Page | Anti HPSE2 pAb (ATL-HPA044603) |
Citations for Anti HPSE2 pAb (ATL-HPA044603) – 1 Found |
Kiyan, Yulia; Tkachuk, Sergey; Kurselis, Kestutis; Shushakova, Nelli; Stahl, Klaus; Dawodu, Damilola; Kiyan, Roman; Chichkov, Boris; Haller, Hermann. Heparanase-2 protects from LPS-mediated endothelial injury by inhibiting TLR4 signalling. Scientific Reports. 2019;9(1):13591. PubMed |