![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/92989/169399/atl-hpa044603_anti-hpse2-pab-atl-hpa044603_51047__22539.1681122809.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)")
Protein Description: heparanase 2 (inactive)
Gene Name: HPSE2
Alternative Gene Name: HPA2, HPR2, UFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074852: 96%, ENSRNOG00000011852: 25%
Entrez Gene ID: 60495
Uniprot ID: Q8WWQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HPSE2
Alternative Gene Name: HPA2, HPR2, UFS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074852: 96%, ENSRNOG00000011852: 25%
Entrez Gene ID: 60495
Uniprot ID: Q8WWQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDDIVRSDVALDKQKGCKIAQHPDVMLELQREKAAQMHLVLLKQQFSNTY |
| Documents & Links for Anti HPSE2 pAb (ATL-HPA044603) | |
| Datasheet | Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link) |
| Vendor Page | Anti HPSE2 pAb (ATL-HPA044603) at Atlas |
| Documents & Links for Anti HPSE2 pAb (ATL-HPA044603) | |
| Datasheet | Anti HPSE2 pAb (ATL-HPA044603) Datasheet (External Link) |
| Vendor Page | Anti HPSE2 pAb (ATL-HPA044603) |
| Citations for Anti HPSE2 pAb (ATL-HPA044603) – 1 Found |
| Kiyan, Yulia; Tkachuk, Sergey; Kurselis, Kestutis; Shushakova, Nelli; Stahl, Klaus; Dawodu, Damilola; Kiyan, Roman; Chichkov, Boris; Haller, Hermann. Heparanase-2 protects from LPS-mediated endothelial injury by inhibiting TLR4 signalling. Scientific Reports. 2019;9(1):13591. PubMed |