Anti HPS4 pAb (ATL-HPA050189)

Atlas Antibodies

SKU:
ATL-HPA050189-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: Hermansky-Pudlak syndrome 4
Gene Name: HPS4
Alternative Gene Name: KIAA1667, LE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042328: 61%, ENSRNOG00000000661: 58%
Entrez Gene ID: 89781
Uniprot ID: Q9NQG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GQRGNKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDR
Gene Sequence GQRGNKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDR
Gene ID - Mouse ENSMUSG00000042328
Gene ID - Rat ENSRNOG00000000661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HPS4 pAb (ATL-HPA050189)
Datasheet Anti HPS4 pAb (ATL-HPA050189) Datasheet (External Link)
Vendor Page Anti HPS4 pAb (ATL-HPA050189) at Atlas Antibodies

Documents & Links for Anti HPS4 pAb (ATL-HPA050189)
Datasheet Anti HPS4 pAb (ATL-HPA050189) Datasheet (External Link)
Vendor Page Anti HPS4 pAb (ATL-HPA050189)