Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA046281-25
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity with a granular pattern in exocrine glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and HPS3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403159).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Hermansky-Pudlak syndrome 3
Gene Name: HPS3
Alternative Gene Name: SUTAL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027615: 79%, ENSRNOG00000031406: 76%
Entrez Gene ID: 84343
Uniprot ID: Q969F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLW
Gene Sequence SKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTRLKEYEQCIDILLERCPEAVIPYANHELKEENRTLW
Gene ID - Mouse ENSMUSG00000027615
Gene ID - Rat ENSRNOG00000031406
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation)
Datasheet Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation)
Datasheet Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HPS3 pAb (ATL-HPA046281 w/enhanced validation)