Anti HP1BP3 pAb (ATL-HPA054295)

Atlas Antibodies

SKU: ATL-HPA054295-25

• 

Protein Description: heterochromatin protein 1, binding protein 3
Gene Name: HP1BP3
Alternative Gene Name: HP1-BP74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028759: 98%, ENSRNOG00000014445: 91%
Entrez Gene ID: 50809
Uniprot ID: Q5SSJ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
• Gene Sequence: ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
• Gene ID - Mouse: ENSMUSG00000028759
• Gene ID - Rat: ENSRNOG00000014445
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.