Anti HP pAb (ATL-HPA047750)

Atlas Antibodies

SKU:
ATL-HPA047750-100
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10<br/>Lane 2: Human cell line HepG2
Shipping:
Calculated at Checkout
$486.00
Adding to cart… The item has been added
Protein Description: haptoglobin
Gene Name: HP
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031722: 81%, ENSRNOG00000014964: 83%
Entrez Gene ID: 3240
Uniprot ID: P00738
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG
Gene Sequence GKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVG
Gene ID - Mouse ENSMUSG00000031722
Gene ID - Rat ENSRNOG00000014964
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HP pAb (ATL-HPA047750)
Datasheet Anti HP pAb (ATL-HPA047750) Datasheet (External Link)
Vendor Page Anti HP pAb (ATL-HPA047750) at Atlas Antibodies

Documents & Links for Anti HP pAb (ATL-HPA047750)
Datasheet Anti HP pAb (ATL-HPA047750) Datasheet (External Link)
Vendor Page Anti HP pAb (ATL-HPA047750)