Protein Description: homeobox D4
Gene Name: HOXD4
Alternative Gene Name: HOX4, HOX4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101174: 84%, ENSRNOG00000001578: 84%
Entrez Gene ID: 3233
Uniprot ID: P09016
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD4
Alternative Gene Name: HOX4, HOX4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101174: 84%, ENSRNOG00000001578: 84%
Entrez Gene ID: 3233
Uniprot ID: P09016
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV |
| Documents & Links for Anti HOXD4 pAb (ATL-HPA070349) | |
| Datasheet | Anti HOXD4 pAb (ATL-HPA070349) Datasheet (External Link) |
| Vendor Page | Anti HOXD4 pAb (ATL-HPA070349) at Atlas |
| Documents & Links for Anti HOXD4 pAb (ATL-HPA070349) | |
| Datasheet | Anti HOXD4 pAb (ATL-HPA070349) Datasheet (External Link) |
| Vendor Page | Anti HOXD4 pAb (ATL-HPA070349) |