Anti HOXD10 pAb (ATL-HPA065871)

Atlas Antibodies

SKU:
ATL-HPA065871-25
  • Immunofluorescent staining of human cell line HEK 293 shows localization to nucleoplasm, cytosol & cytoplasmic bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added

Product Description

Protein Description: homeobox D10
Gene Name: HOXD10
Alternative Gene Name: HOX4, HOX4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050368: 99%, ENSRNOG00000001581: 99%
Entrez Gene ID: 3236
Uniprot ID: P28358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENP
Gene Sequence AKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENP
Gene ID - Mouse ENSMUSG00000050368
Gene ID - Rat ENSRNOG00000001581
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti HOXD10 pAb (ATL-HPA065871)
Datasheet Anti HOXD10 pAb (ATL-HPA065871) Datasheet (External Link)
Vendor Page Anti HOXD10 pAb (ATL-HPA065871) at Atlas Antibodies

Documents & Links for Anti HOXD10 pAb (ATL-HPA065871)
Datasheet Anti HOXD10 pAb (ATL-HPA065871) Datasheet (External Link)
Vendor Page Anti HOXD10 pAb (ATL-HPA065871)