Protein Description: homeobox D10
Gene Name: HOXD10
Alternative Gene Name: HOX4, HOX4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050368: 99%, ENSRNOG00000001581: 99%
Entrez Gene ID: 3236
Uniprot ID: P28358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HOXD10
Alternative Gene Name: HOX4, HOX4D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050368: 99%, ENSRNOG00000001581: 99%
Entrez Gene ID: 3236
Uniprot ID: P28358
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | AKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENP |
Documents & Links for Anti HOXD10 pAb (ATL-HPA065871) | |
Datasheet | Anti HOXD10 pAb (ATL-HPA065871) Datasheet (External Link) |
Vendor Page | Anti HOXD10 pAb (ATL-HPA065871) at Atlas |
Documents & Links for Anti HOXD10 pAb (ATL-HPA065871) | |
Datasheet | Anti HOXD10 pAb (ATL-HPA065871) Datasheet (External Link) |
Vendor Page | Anti HOXD10 pAb (ATL-HPA065871) |