Anti HOXC10 pAb (ATL-HPA053919)

Atlas Antibodies

SKU:
ATL-HPA053919-25
  • Immunohistochemical staining of human vulva/anal skin moderate nuclear positivity in epidermal cells.
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm & nuclear bodies.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: homeobox C10
Gene Name: HOXC10
Alternative Gene Name: HOX3I
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022484: 96%, ENSRNOG00000016149: 97%
Entrez Gene ID: 3226
Uniprot ID: Q9NYD6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQP
Gene Sequence MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGSSPSLALNTYPSYLSQLDSWGDPKAAYRLEQP
Gene ID - Mouse ENSMUSG00000022484
Gene ID - Rat ENSRNOG00000016149
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HOXC10 pAb (ATL-HPA053919)
Datasheet Anti HOXC10 pAb (ATL-HPA053919) Datasheet (External Link)
Vendor Page Anti HOXC10 pAb (ATL-HPA053919) at Atlas Antibodies

Documents & Links for Anti HOXC10 pAb (ATL-HPA053919)
Datasheet Anti HOXC10 pAb (ATL-HPA053919) Datasheet (External Link)
Vendor Page Anti HOXC10 pAb (ATL-HPA053919)