Anti HOXB4 pAb (ATL-HPA057432)

Atlas Antibodies

SKU: ATL-HPA057432-25

• 
• 

Protein Description: homeobox B4
Gene Name: HOXB4
Alternative Gene Name: HOX2, HOX2F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038692: 97%, ENSRNOG00000008191: 94%
Entrez Gene ID: 3214
Uniprot ID: P17483
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY
• Gene Sequence: CEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVY
• Gene ID - Mouse: ENSMUSG00000038692
• Gene ID - Rat: ENSRNOG00000008191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HOXB4 pAb (ATL-HPA057432) – 1 Found

Xu, Jia; Huang, Liang-Jiang; Fang, Zhengyu; Luo, Hong-Mei; Chen, Yun-Qiang; Li, Ya-Jie; Gong, Chen-Zi; Chen, Hong. Spinal dI4 Interneuron Differentiation From Human Pluripotent Stem Cells. Frontiers In Molecular Neuroscience. 15( 35465095):845875.