Anti HNRNPU pAb (ATL-HPA058707)

Atlas Antibodies

SKU: ATL-HPA058707-100

• 
• 
• 

Protein Description: heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
Gene Name: HNRNPU
Alternative Gene Name: hnRNPU, HNRPU, SAF-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111145: 100%, ENSRNOG00000033790: 100%
Entrez Gene ID: 3192
Uniprot ID: Q00839
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGG
• Gene Sequence: AVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGG
• Gene ID - Mouse: ENSMUSG00000111145
• Gene ID - Rat: ENSRNOG00000033790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPU pAb (ATL-HPA058707) – 1 Found

Durślewicz, Justyna; Jóźwicki, Jakub; Klimaszewska-Wiśniewska, Anna; Zielińska, Aleksandra; Antosik, Paulina; Grzanka, Dariusz; Braun, Marcin. High expression of RUVBL1 and HNRNPU is associated with poor overall survival in stage I and II non-small cell lung cancer patients. Discover Oncology. 2022;13(1):106.