Anti HNRNPLL pAb (ATL-HPA046084)

Atlas Antibodies

SKU:
ATL-HPA046084-25
  • Immunohistochemical staining of human fallopian tube shows nuclear and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: heterogeneous nuclear ribonucleoprotein L-like
Gene Name: HNRNPLL
Alternative Gene Name: HNRPLL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024095: 95%, ENSRNOG00000006929: 95%
Entrez Gene ID: 92906
Uniprot ID: Q8WVV9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTD
Gene Sequence QASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTD
Gene ID - Mouse ENSMUSG00000024095
Gene ID - Rat ENSRNOG00000006929
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HNRNPLL pAb (ATL-HPA046084)
Datasheet Anti HNRNPLL pAb (ATL-HPA046084) Datasheet (External Link)
Vendor Page Anti HNRNPLL pAb (ATL-HPA046084) at Atlas Antibodies

Documents & Links for Anti HNRNPLL pAb (ATL-HPA046084)
Datasheet Anti HNRNPLL pAb (ATL-HPA046084) Datasheet (External Link)
Vendor Page Anti HNRNPLL pAb (ATL-HPA046084)