Anti HNRNPL pAb (ATL-HPA052661)

Atlas Antibodies

SKU: ATL-HPA052661-25

• 
• 
• 

Protein Description: heterogeneous nuclear ribonucleoprotein L
Gene Name: HNRNPL
Alternative Gene Name: HNRPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015165: 100%, ENSRNOG00000020235: 100%
Entrez Gene ID: 3191
Uniprot ID: P14866
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRY
• Gene Sequence: DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGPPPPHYEGRRMGPPVGGHRRGPSRY
• Gene ID - Mouse: ENSMUSG00000015165
• Gene ID - Rat: ENSRNOG00000020235
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HNRNPL pAb (ATL-HPA052661) – 1 Found

van Well, Eva M; Bader, Verian; Patra, Maria; Sánchez-Vicente, Ana; Meschede, Jens; Furthmann, Nikolas; Schnack, Cathrin; Blusch, Alina; Longworth, Joseph; Petrasch-Parwez, Elisabeth; Mori, Kohji; Arzberger, Thomas; Trümbach, Dietrich; Angersbach, Lena; Showkat, Cathrin; Sehr, Dominik A; Berlemann, Lena A; Goldmann, Petra; Clement, Albrecht M; Behl, Christian; Woerner, Andreas C; Saft, Carsten; Wurst, Wolfgang; Haass, Christian; Ellrichmann, Gisa; Gold, Ralf; Dittmar, Gunnar; Hipp, Mark S; Hartl, F Ulrich; Tatzelt, Jörg; Winklhofer, Konstanze F. A protein quality control pathway regulated by linear ubiquitination. The Embo Journal. 2019;38(9)