Protein Description: histamine N-methyltransferase
Gene Name: HNMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026986: 79%, ENSRNOG00000005223: 78%
Entrez Gene ID: 3176
Uniprot ID: P50135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: HNMT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026986: 79%, ENSRNOG00000005223: 78%
Entrez Gene ID: 3176
Uniprot ID: P50135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | VKFAWHKETSSEYQSRMLEKKELQKWDFIHMIQMLYYVKDIPATLKFFHSLLGTNAKMLIIVVSGSSGWDKLWKKYGSRFPQDDLCQYI |
Documents & Links for Anti HNMT pAb (ATL-HPA073754) | |
Datasheet | Anti HNMT pAb (ATL-HPA073754) Datasheet (External Link) |
Vendor Page | Anti HNMT pAb (ATL-HPA073754) at Atlas |
Documents & Links for Anti HNMT pAb (ATL-HPA073754) | |
Datasheet | Anti HNMT pAb (ATL-HPA073754) Datasheet (External Link) |
Vendor Page | Anti HNMT pAb (ATL-HPA073754) |