Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA056191-25
  • Immunohistochemistry analysis in human cerebral cortex and tonsil tissues using HPA056191 antibody. Corresponding HMP19 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: HMP19 protein
Gene Name: HMP19
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020297: 98%, ENSRNOG00000020644: 98%
Entrez Gene ID: 51617
Uniprot ID: Q9Y328
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Gene Sequence RCIPASLDAYYSSQDPNSRSRFYTVISHYSVAKQSTARAIGPWLSAAAVIHEPKPPKTQGH
Gene ID - Mouse ENSMUSG00000020297
Gene ID - Rat ENSRNOG00000020644
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation)
Datasheet Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation)
Datasheet Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMP19 pAb (ATL-HPA056191 w/enhanced validation)