Anti HMG20B pAb (ATL-HPA053157)

Atlas Antibodies

SKU:
ATL-HPA053157-25
  • Immunofluorescent staining of human cell line HeLa shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: high mobility group 20B
Gene Name: HMG20B
Alternative Gene Name: BRAF25, BRAF35, HMGX2, HMGXB2, SMARCE1r, SOXL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020232: 90%, ENSRNOG00000020601: 89%
Entrez Gene ID: 10362
Uniprot ID: Q9P0W2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen REKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVP
Gene Sequence REKQQYMKELRAYQQSEAYKMCTEKIQEKKIKKEDSSSGLMNTLLNGHKGGDCDGFSTFDVP
Gene ID - Mouse ENSMUSG00000020232
Gene ID - Rat ENSRNOG00000020601
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HMG20B pAb (ATL-HPA053157)
Datasheet Anti HMG20B pAb (ATL-HPA053157) Datasheet (External Link)
Vendor Page Anti HMG20B pAb (ATL-HPA053157) at Atlas Antibodies

Documents & Links for Anti HMG20B pAb (ATL-HPA053157)
Datasheet Anti HMG20B pAb (ATL-HPA053157) Datasheet (External Link)
Vendor Page Anti HMG20B pAb (ATL-HPA053157)