Anti HMCES pAb (ATL-HPA044968 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044968-25

• 
• 
• 

Protein Description: 5-hydroxymethylcytosine (hmC) binding, ES cell-specific
Gene Name: HMCES
Alternative Gene Name: C3orf37, DC12, SRAPD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030060: 87%, ENSRNOG00000010474: 88%
Entrez Gene ID: 56941
Uniprot ID: Q96FZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS
• Gene Sequence: WRLLTMAGIFDCWEPPEGGDVLYSYTIITVDSCKGLSDIHHRMPAILDGEEAVSKWLDFGEVSTQEALKLIHPTENITFHAVSSVVNNS
• Gene ID - Mouse: ENSMUSG00000030060
• Gene ID - Rat: ENSRNOG00000010474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti HMCES pAb (ATL-HPA044968 w/enhanced validation) – 5 Found

Srivastava, Mrinal; Su, Dan; Zhang, Huimin; Chen, Zhen; Tang, Mengfan; Nie, Litong; Chen, Junjie. HMCES safeguards replication from oxidative stress and ensures error-free repair. Embo Reports. 2020;21(6):e49123. 

Mohni, Kareem N; Wessel, Sarah R; Zhao, Runxiang; Wojciechowski, Andrea C; Luzwick, Jessica W; Layden, Hillary; Eichman, Brandt F; Thompson, Petria S; Mehta, Kavi P M; Cortez, David. HMCES Maintains Genome Integrity by Shielding Abasic Sites in Single-Strand DNA. Cell. 2019;176(1-2):144-153.e13. 

Mehta, Kavi P M; Lovejoy, Courtney A; Zhao, Runxiang; Heintzman, Darren R; Cortez, David. HMCES Maintains Replication Fork Progression and Prevents Double-Strand Breaks in Response to APOBEC Deamination and Abasic Site Formation. Cell Reports. 2020;31(9):107705. 

Biayna, Josep; Garcia-Cao, Isabel; Álvarez, Miguel M; Salvadores, Marina; Espinosa-Carrasco, Jose; McCullough, Marcel; Supek, Fran; Stracker, Travis H. Loss of the abasic site sensor HMCES is synthetic lethal with the activity of the APOBEC3A cytosine deaminase in cancer cells. Plos Biology. 2021;19(3):e3001176. 

Wu, Lizhen; Shukla, Vipul; Yadavalli, Anurupa Devi; Dinesh, Ravi K; Xu, Dijin; Rao, Anjana; Schatz, David G. HMCES protects immunoglobulin genes specifically from deletions during somatic hypermutation. Genes & Development. 2022;36(7-8):433-450.