Anti HMBS pAb (ATL-HPA050659 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA050659-25
  • Immunohistochemistry analysis in human bone marrow and cerebral cortex tissues using Anti-HMBS antibody. Corresponding HMBS RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to lipid droplets.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: hydroxymethylbilane synthase
Gene Name: HMBS
Alternative Gene Name: PBGD, PORC, UPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032126: 93%, ENSRNOG00000010390: 94%
Entrez Gene ID: 3145
Uniprot ID: P08397
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLV
Gene Sequence EFSAIILATAGLQRMGWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLV
Gene ID - Mouse ENSMUSG00000032126
Gene ID - Rat ENSRNOG00000010390
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti HMBS pAb (ATL-HPA050659 w/enhanced validation)
Datasheet Anti HMBS pAb (ATL-HPA050659 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMBS pAb (ATL-HPA050659 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti HMBS pAb (ATL-HPA050659 w/enhanced validation)
Datasheet Anti HMBS pAb (ATL-HPA050659 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti HMBS pAb (ATL-HPA050659 w/enhanced validation)